CJC-1295 with DAC /C (863288-34-0)-Shanghai Getian Industrial Co.,Ltd

　Products

Peptide
Ungrouped

Peptide

CJC-1295 with DAC /C (863288-34-0)

Detailed Description
Name: cjc1295
Synonyms: CJC-1295(2MG); CJC-1295 Acetate; CJC-1295 CJC-1295; CJC1295 with out DAC; eucylserylargininamide; rtylisoleucylleucylseryl-; CJC-1295/CJC1-295(WITHOUT DAC); Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; -L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl
CAS Registry number: 863288-34-0
EINECS：206-141-6
Molecular Formula: C152H252N44O42
Refractive index: 1.644
Density: 1.45

Shanghai Getian Industrial Co.,Ltd. is a professional company engaged in health care products, cosmetics raw materials,
with rich experience and high-quality talent team. We are committed to providing customers with quality, efficient and professional services to help customers realize their dreams.Our company has a good reputation in the industry, thanks to our professional team...